ChEMBL ligand: CHEMBL316034 (2,4-Pyridine Dicarboxylic Acid, Pyridine-2,4-Dicarboxylic Acid)
Alpha-ketoglutarate-dependent dioxygenase FTO in Human [ChEMBL: CHEMBL2331065] [UniProtKB: Q9C0B1] There should be some charts here, you may need to enable JavaScript!
Aspartyl/asparaginyl beta-hydroxylase in Human [ChEMBL: CHEMBL4680030] [UniProtKB: Q12797] There should be some charts here, you may need to enable JavaScript!
Beta-lactamase in Aeromonas hydrophila [ChEMBL: CHEMBL3885662] [UniProtKB: Q44079] There should be some charts here, you may need to enable JavaScript!
lysine demethylase 8/Bifunctional peptidase and arginyl-hydroxylase JMJD5 in Human [ChEMBL: CHEMBL4523396] [GtoPdb: 2687] [UniProtKB: Q8N371] There should be some charts here, you may need to enable JavaScript!
egl-9 family hypoxia inducible factor 1/Egl nine homolog 1 in Human [ChEMBL: CHEMBL5697] [GtoPdb: 2833] [UniProtKB: Q9GZT9] There should be some charts here, you may need to enable JavaScript!
egl-9 family hypoxia inducible factor 3/Egl nine homolog 3 in Human [ChEMBL: CHEMBL5705] [GtoPdb: 2834] [UniProtKB: Q9H6Z9] There should be some charts here, you may need to enable JavaScript!
Gamma-butyrobetaine dioxygenase in Human [ChEMBL: CHEMBL2163175] [UniProtKB: O75936] There should be some charts here, you may need to enable JavaScript!
Hypoxia-inducible factor 1-alpha inhibitor in Human [ChEMBL: CHEMBL5909] [UniProtKB: Q9NWT6] There should be some charts here, you may need to enable JavaScript!
egl-9 family hypoxia inducible factor 2/Hypoxia-inducible factor prolyl hydroxylase 1 in Human [ChEMBL: CHEMBL3028] [GtoPdb: 2832] [UniProtKB: Q96KS0] There should be some charts here, you may need to enable JavaScript!
lysine demethylase 2A/Lysine-specific demethylase 2A in Human [ChEMBL: CHEMBL1938210] [GtoPdb: 2671] [UniProtKB: Q9Y2K7] There should be some charts here, you may need to enable JavaScript!
lysine demethylase 3A/Lysine-specific demethylase 3A in Human [ChEMBL: CHEMBL1938209] [GtoPdb: 2673] [UniProtKB: Q9Y4C1] There should be some charts here, you may need to enable JavaScript!
lysine demethylase 4A/Lysine-specific demethylase 4A in Human [ChEMBL: CHEMBL5896] [GtoPdb: 2675] [UniProtKB: O75164] There should be some charts here, you may need to enable JavaScript!
lysine demethylase 4C/Lysine-specific demethylase 4C in Human [ChEMBL: CHEMBL6175] [GtoPdb: 2677] [UniProtKB: Q9H3R0] There should be some charts here, you may need to enable JavaScript!
lysine demethylase 4D/Lysine-specific demethylase 4D in Human [ChEMBL: CHEMBL6138] [GtoPdb: 2678] [UniProtKB: Q6B0I6] There should be some charts here, you may need to enable JavaScript!
lysine demethylase 4E/Lysine-specific demethylase 4D-like in Human [ChEMBL: CHEMBL1293226] [GtoPdb: 2679] [UniProtKB: B2RXH2] There should be some charts here, you may need to enable JavaScript!
lysine demethylase 5A/Lysine-specific demethylase 5A in Human [ChEMBL: CHEMBL2424504] [GtoPdb: 2680] [UniProtKB: P29375] There should be some charts here, you may need to enable JavaScript!
lysine demethylase 5B/Lysine-specific demethylase 5B in Human [ChEMBL: CHEMBL3774295] [GtoPdb: 2681] [UniProtKB: Q9UGL1] There should be some charts here, you may need to enable JavaScript!
lysine demethylase 5C/Lysine-specific demethylase 5C in Human [ChEMBL: CHEMBL2163176] [GtoPdb: 2682] [UniProtKB: P41229] There should be some charts here, you may need to enable JavaScript!
lysine demethylase 6B/Lysine-specific demethylase 6B in Human [ChEMBL: CHEMBL1938211] [GtoPdb: 2685] [UniProtKB: O15054] There should be some charts here, you may need to enable JavaScript!
lysine demethylase 7A/Lysine-specific demethylase 7 in Human [ChEMBL: CHEMBL2163177] [GtoPdb: 2686] [UniProtKB: Q6ZMT4] There should be some charts here, you may need to enable JavaScript!
Methylcytosine dioxygenase TET1 in Human [ChEMBL: CHEMBL4523402] [UniProtKB: Q8NFU7] There should be some charts here, you may need to enable JavaScript!
Methylcytosine dioxygenase TET2 in Human [ChEMBL: CHEMBL4523344] [UniProtKB: Q6N021] There should be some charts here, you may need to enable JavaScript!
Methylcytosine dioxygenase TET3 in Human [ChEMBL: CHEMBL4879414] [UniProtKB: O43151] There should be some charts here, you may need to enable JavaScript!
Prolyl 4-hydroxylase in Paramecium bursaria Chlorella virus 1 [ChEMBL: CHEMBL4523368] [UniProtKB: Q84406] There should be some charts here, you may need to enable JavaScript!
RNA demethylase ALKBH5 in Human [ChEMBL: CHEMBL3621037] [UniProtKB: Q6P6C2] There should be some charts here, you may need to enable JavaScript!

DB	Assay description	Assay Type	Standard value	Standard parameter	Original value	Original units	Original parameter	Reference
Alpha-ketoglutarate-dependent dioxygenase FTO in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2331065] [UniProtKB: Q9C0B1]
ChEMBL	Inhibition of human hexahistidine-tagged full-length FTO expressed in Escherichia coli BL21 (DE3) using 3-methylthymidine as substrate assessed as inhibition of 3-methylthymidine conversion to thymidine after 1 hr by liquid chromatographic analysis	B	5.08	pIC50	8300	nM	IC50	J Med Chem (2013) 56: 3680-3688 [PMID:23547775]
Aspartyl/asparaginyl beta-hydroxylase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4680030] [UniProtKB: Q12797]
ChEMBL	Inhibition of N-His6-tagged human AspH (315-755) expressed in Escherichia coli BL21 (DE3) using 1 uM hFX-CP as substrate mixture with high 200 uM 2OG, 100 uM L-ascorbic acid and 2 uM FAS incubated for 35 mins by MS analysis	B	7	pIC50	100	nM	IC50	Bioorg Med Chem (2020) 28: 115675-115675 [PMID:33069066]
ChEMBL	Inhibition of N-His6-tagged human AspH (315-755) expressed in Escherichia coli BL21 (DE3) using 1 uM hFX-CP as substrate mixture with 3 uM 2OG, 100 uM L-ascorbic acid and high 20 uM FAS incubated for 35 mins by MS analysis	B	7.52	pIC50	30	nM	IC50	Bioorg Med Chem (2020) 28: 115675-115675 [PMID:33069066]
ChEMBL	Inhibition of N-His6-tagged human AspH (315-755) expressed in Escherichia coli BL21 (DE3) using 1 uM hFX-CP as substrate mixture with 3 uM 2OG, 100 uM L-ascorbic acid and 2 uM FAS incubated for 35 mins by MS analysis	B	7.7	pIC50	20	nM	IC50	Bioorg Med Chem (2020) 28: 115675-115675 [PMID:33069066]
ChEMBL	Inhibition of N-His6-tagged human AspH (315-755) expressed in Escherichia coli BL21 (DE3) using high 10 uM hFX-CP as substrate mixture with 10 uM 2OG, 100 uM L-ascorbic acid and 2 uM FAS incubated for 35 mins by MS analysis	B	7.7	pIC50	20	nM	IC50	Bioorg Med Chem (2020) 28: 115675-115675 [PMID:33069066]
Beta-lactamase in Aeromonas hydrophila (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3885662] [UniProtKB: Q44079]
ChEMBL	Inhibition of Aeromonas hydrophila beta lactamase CphA at pH 8.0	B	4.46	pKi	35000	nM	Ki	Antimicrob Agents Chemother (2007) 51: 2136-2142 [PMID:17307979]
ChEMBL	Inhibition of Aeromonas hydrophila beta lactamase CphA at pH 7.0	B	4.77	pKi	17000	nM	Ki	Antimicrob Agents Chemother (2007) 51: 2136-2142 [PMID:17307979]
ChEMBL	Inhibition of Aeromonas hydrophila beta lactamase CphA by competitive inhibition assay	B	5.35	pKi	4500	nM	Ki	Antimicrob Agents Chemother (2007) 51: 2136-2142 [PMID:17307979]
lysine demethylase 8/Bifunctional peptidase and arginyl-hydroxylase JMJD5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4523396] [GtoPdb: 2687] [UniProtKB: Q8N371]
ChEMBL	Inhibition of N-terminal his6-tagged human recombinant JMJD5 (183 to 416 residues) using RPS6 as substrate by SPE-MS analysis	B	6.3	pIC50	500	nM	IC50	J Med Chem (2023) 66: 10849-10865 [PMID:37527664]
egl-9 family hypoxia inducible factor 1/Egl nine homolog 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5697] [GtoPdb: 2833] [UniProtKB: Q9GZT9]
ChEMBL	Binding affinity to human PHD2 catalytic domain (181 to 426) Mn2 expressed in Escherichia coli by NMR spectroscopic analysis	B	6.38	pKd	420	nM	Kd	J Med Chem (2013) 56: 547-555 [PMID:23234607]
ChEMBL	Inhibition of human recombinant PHD2	B	5.15	pKi	7000	nM	Ki	J Med Chem (2008) 51: 7053-7056 [PMID:18942826]
ChEMBL	Inhibition of recombinant human PHD2 using 2OG as substrate and Fe2 as co-factor assessed as hydroxylation incubated for 15 mins in presence of L-ascorbate by LC-MS analysis	B	5.15	pIC50	7000	nM	IC50	Bioorg Med Chem (2019) 27: 2405-2412 [PMID:30737136]
ChEMBL	Inhibition of human recombinant PHD2 expressed in Sf9 cells by time-resolved fluorescence assay	B	5.21	pIC50	6100	nM	IC50	J Med Chem (2010) 53: 5629-5638 [PMID:20684604]
ChEMBL	Inhibition of PHD2 (unknown origin)	B	5.22	pIC50	6000	nM	IC50	J Med Chem (2021) 64: 16974-17003 [PMID:34792334]
ChEMBL	Inhibition of human PHD2 catalytic domain (181 to 426) Mn2 expressed in Escherichia coli by NMR spectroscopic analysis	B	5.7	pIC50	2000	nM	IC50	J Med Chem (2013) 56: 547-555 [PMID:23234607]
egl-9 family hypoxia inducible factor 3/Egl nine homolog 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5705] [GtoPdb: 2834] [UniProtKB: Q9H6Z9]
ChEMBL	Inhibition of human recombinant HIF PHD3	B	5.15	pKi	7000	nM	Ki	J Med Chem (2008) 51: 7053-7056 [PMID:18942826]
Gamma-butyrobetaine dioxygenase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2163175] [UniProtKB: O75936]
ChEMBL	Inhibition of BBOX1 (unknown origin)	B	4.09	pIC50	82000	nM	IC50	J Med Chem (2021) 64: 16974-17003 [PMID:34792334]
Hypoxia-inducible factor 1-alpha inhibitor in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5909] [UniProtKB: Q9NWT6]
ChEMBL	Inhibition of N-terminal His6-tagged full-length FIH (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using SMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN peptide/100 uM alpha-ketoglutarate as substrate/cofactor incubated for 45 mins by MALDI assay	B	5.07	pIC50	8600	nM	IC50	J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL	Inhibition of FIH (unknown origin)	B	5.96	pIC50	1100	nM	IC50	J Med Chem (2021) 64: 16974-17003 [PMID:34792334]
egl-9 family hypoxia inducible factor 2/Hypoxia-inducible factor prolyl hydroxylase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3028] [GtoPdb: 2832] [UniProtKB: Q96KS0]
ChEMBL	Inhibition of human recombinant HIF PHD1	B	5.15	pKi	7000	nM	Ki	J Med Chem (2008) 51: 7053-7056 [PMID:18942826]
ChEMBL	Inhibition of human recombinant PHD1 expressed in Sf9 cells by time-resolved fluorescence assay	B	5.82	pIC50	1500	nM	IC50	J Med Chem (2010) 53: 5629-5638 [PMID:20684604]
lysine demethylase 2A/Lysine-specific demethylase 2A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1938210] [GtoPdb: 2671] [UniProtKB: Q9Y2K7]
ChEMBL	Inhibition of KDM2A (unknown origin) expressed in Escherichia coli using Biotin H3 (28 to 48 residues) Me2 KDM2A Cognate Ligande/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 15 mins followed by substrate addition measured after 30 mins by alphascreen assay	B	4.89	pIC50	12800	nM	IC50	J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL	Inhibition of KDM2A (unknown origin)	B	5.39	pIC50	4100	nM	IC50	J Med Chem (2013) 56: 7222-7231 [PMID:23964788]
ChEMBL	Inhibition of KDM2A (unknown origin)	B	5.39	pIC50	4100	nM	IC50	J Med Chem (2021) 64: 16974-17003 [PMID:34792334]
ChEMBL	Inhibition of KDM2A (unknown origin)	B	5.4	pIC50	3981.07	nM	IC50	Medchemcomm (2014) 5: 1879-1886 [PMID:26682034]
lysine demethylase 3A/Lysine-specific demethylase 3A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1938209] [GtoPdb: 2673] [UniProtKB: Q9Y4C1]
ChEMBL	Inhibition of KDM3A (unknown origin)	B	5.1	pIC50	7943.28	nM	IC50	Medchemcomm (2014) 5: 1879-1886 [PMID:26682034]
ChEMBL	Inhibition of KDM3A (unknown origin) expressed in Escherichia coli using H3 (1 to 21 residues) K9Me2-GGK-Biotin KDM3A Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 20 mins by alphascreen assay	B	5.48	pIC50	3300	nM	IC50	J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
lysine demethylase 4A/Lysine-specific demethylase 4A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5896] [GtoPdb: 2675] [UniProtKB: O75164]
ChEMBL	Inhibition of recombinant His-tagged JMJD2A expressed in Escherichia coli Rosetta 2 (DE3) pLysS cells by formaldehyde dehydrogenase-coupled assay	B	5.38	pIC50	4200	nM	IC50	J Med Chem (2010) 53: 5629-5638 [PMID:20684604]
ChEMBL	Inhibition of KDM4A (unknown origin) using H3K9me3 peptide and 2-oxoglutarate as substrate after 1 hr by FDH-coupled assay	B	5.38	pIC50	4200	nM	IC50	J Med Chem (2013) 56: 7222-7231 [PMID:23964788]
GtoPdb	FDH (formaldehyde dehydrogenase) coupled assay.	-	6.15	pIC50	700	nM	IC50	J Med Chem (2008) 51: 7053-6 [PMID:18942826]
ChEMBL	Inhibition of human JMJD2A by FDH coupled assay	B	6.15	pIC50	700	nM	IC50	J Med Chem (2008) 51: 7053-7056 [PMID:18942826]
lysine demethylase 4C/Lysine-specific demethylase 4C in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6175] [GtoPdb: 2677] [UniProtKB: Q9H3R0]
ChEMBL	Inhibition of KDM4C catalytic core-mediated demethylation of ARK(Me)3STGGK after 30 mins by FDH-coupled assay	B	4.89	pKi	13000	nM	Ki	Bioorg Med Chem Lett (2012) 22: 5811-5813 [PMID:22917519]
ChEMBL	Competitive inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using ARK(Me3)STGGK peptide/alpha-ketoglutarate as substrate/cofactor by FDH coupling-based Lineweaver-Burk plot analysis	B	8.66	pKi	2.2	nM	Ki	J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL	Inhibition of KDM4C catalytic core-mediated demethylation of ARK(Me)3STGGK after 30 mins by FDH-coupled assay	B	4.41	pIC50	39000	nM	IC50	Bioorg Med Chem Lett (2012) 22: 5811-5813 [PMID:22917519]
ChEMBL	Inhibition of recombinant His-tagged JMJD2C expressed in Escherichia coli Rosetta 2 (DE3) pLysS cells by formaldehyde dehydrogenase-coupled assay	B	5.03	pIC50	9400	nM	IC50	J Med Chem (2010) 53: 5629-5638 [PMID:20684604]
ChEMBL	Inhibition of KDM4C (unknown origin) using H3K9me3 peptide and 2-oxoglutarate as substrate after 1 hr by FDH-coupled assay	B	5.09	pIC50	8200	nM	IC50	J Med Chem (2013) 56: 7222-7231 [PMID:23964788]
ChEMBL	Inhibition of KDM4C (unknown origin)	B	5.6	pIC50	2511.89	nM	IC50	Medchemcomm (2014) 5: 1879-1886 [PMID:26682034]
ChEMBL	Inhibition of KDM4C	B	5.62	pIC50	2400	nM	IC50	Bioorg Med Chem Lett (2012) 22: 5811-5813 [PMID:22917519]
ChEMBL	Competitive inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using 250 uM ARK(Me3)STGGK peptide/50 uM alpha-ketoglutarate as substrate/cofactor by FDH coupling-based Lineweaver-Burk plot analysis	B	5.72	pIC50	1900	nM	IC50	J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL	Competitive inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using 50 uM ARK(Me3)STGGK peptide/50 uM alpha-ketoglutarate as substrate/cofactor by FDH coupling-based Lineweaver-Burk plot analysis	B	5.82	pIC50	1500	nM	IC50	J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL	Inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using biotinylated peptide/ 2 uM alpha-ketoglutarate as substrate/cofactor preincubated for 15 mins followed by substrate addition measured after 15 mins by alphascreen assay	B	5.92	pIC50	1200	nM	IC50	J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL	Inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using ARTKQTARK(Me3)STGGKA peptide/100 uM alpha-ketoglutarate as substrate/cofactor incubated for 45 mins by MALDI assay	B	6.21	pIC50	620	nM	IC50	J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL	Competitive inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using 50 uM ARK(Me3)STGGK peptide/5 uM alpha-ketoglutarate as substrate/cofactor by FDH coupling-based Lineweaver-Burk plot analysis	B	6.28	pIC50	530	nM	IC50	J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL	Inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using biotinylated histone H3 (1 to 21 residues) lysine 9 trimethylated peptide/2 uM alpha-ketoglutarate as substrate/cofactor measured after 45 mins by TR-FRET assay	B	6.73	pIC50	188	nM	IC50	J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL	Inhibition of KDM4C (unknown origin)	B	7.72	pIC50	19	nM	IC50	Eur J Med Chem (2020) 208: 112760-112760 [PMID:32883639]
lysine demethylase 4D/Lysine-specific demethylase 4D in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6138] [GtoPdb: 2678] [UniProtKB: Q6B0I6]
ChEMBL	Inhibition of KDM4D (unknown origin) expressed in Escherichia coli using H3 (1 to 21 residues) K9Me3-GGK-Biotin KDM4 Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 20 mins by alphascreen assay	B	5.62	pIC50	2400	nM	IC50	J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
lysine demethylase 4E/Lysine-specific demethylase 4D-like in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1293226] [GtoPdb: 2679] [UniProtKB: B2RXH2]
ChEMBL	Inhibition of KDM4E (unknown origin)	B	5.2	pIC50	6309.57	nM	IC50	Medchemcomm (2014) 5: 1879-1886 [PMID:26682034]
ChEMBL	Inhibition of KDM4E (unknown origin)	B	5.33	pIC50	4700	nM	IC50	J Med Chem (2021) 64: 16974-17003 [PMID:34792334]
ChEMBL	Inhibition of KDM4E (unknown origin ) incubated for 20 mins by Alphascreen assay	B	5.52	pIC50	3000	nM	IC50	Eur J Med Chem (2021) 226: 113855-113855 [PMID:34555614]
GtoPdb	FDH (formaldehyde dehydrogenase) coupled assay.	-	5.85	pIC50	1400	nM	IC50	J Med Chem (2008) 51: 7053-6 [PMID:18942826]
ChEMBL	Inhibition of his6-tagged human recombinant KDM4E using K9me3 as substrate by SPE-MS analysis	B	6.52	pIC50	300	nM	IC50	J Med Chem (2023) 66: 10849-10865 [PMID:37527664]
lysine demethylase 5A/Lysine-specific demethylase 5A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2424504] [GtoPdb: 2680] [UniProtKB: P29375]
ChEMBL	Inhibition of KDM5A (unknown origin) using H3K4me3 peptide and 2-oxoglutarate as substrate after 1 hr by FDH-coupled assay	B	4	pIC50	100000	nM	IC50	J Med Chem (2013) 56: 7222-7231 [PMID:23964788]
ChEMBL	Inhibition of N-terminal his6-tagged human KDM5A (1 to 797 residues) expressed in sf9 insect cells incubated for 20 mins by Alphascreen assay	B	5.31	pIC50	4920	nM	IC50	Eur J Med Chem (2021) 226: 113855-113855 [PMID:34555614]
ChEMBL	Inhibition of KDM5A (1 to 797 residues) (unknown origin) expressed in insect sf21 cells using ARTK(Me3)QTARKSTGGKAPRK peptide/ 100 uM alpha-ketoglutarate as substrate/cofactor incubated for 45 mins by MALDI assay	B	6.12	pIC50	760	nM	IC50	J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
lysine demethylase 5B/Lysine-specific demethylase 5B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3774295] [GtoPdb: 2681] [UniProtKB: Q9UGL1]
ChEMBL	Inhibition of recombinant KDM5B catalytic domain (1 to 769 residues) (unknown origin)	B	5.52	pIC50	3000	nM	IC50	Eur J Med Chem (2019) 161: 131-140 [PMID:30343192]
ChEMBL	Inhibition of recombinant KDM5B catalytic core (1 to 729 residues) (unknown origin) expressed in baculovirus infected insect cells by FDH coupled assay	B	5.52	pIC50	3000	nM	IC50	Eur J Med Chem (2020) 208: 112760-112760 [PMID:32883639]
ChEMBL	Inhibition of KDM5B (unknown origin)	B	5.52	pIC50	3000	nM	IC50	Eur J Med Chem (2023) 251: 115250-115250 [PMID:36931124]
ChEMBL	Inhibition of KDM5B (unknown origin) expressed in Escherichia coli using H3 (1 to 21 residues) K4Me3-GGK-Biotin KDM5B Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 20 mins by alphascreen assay	B	5.57	pIC50	2700	nM	IC50	J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
lysine demethylase 5C/Lysine-specific demethylase 5C in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2163176] [GtoPdb: 2682] [UniProtKB: P41229]
ChEMBL	Inhibition of KDM5C (unknown origin)	B	6.3	pIC50	501.19	nM	IC50	Medchemcomm (2014) 5: 1879-1886 [PMID:26682034]
lysine demethylase 6B/Lysine-specific demethylase 6B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1938211] [GtoPdb: 2685] [UniProtKB: O15054]
ChEMBL	Inhibition of KDM6B (unknown origin) expressed in Escherichia coli using H3 (21 to 44 residues) K27Me3-GGK-Biotin JMJD3 Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 5 mins by alphascreen assay	B	4.35	pIC50	44600	nM	IC50	J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL	Inhibition of KDM6B (unknown origin)	B	4.5	pIC50	31622.78	nM	IC50	Medchemcomm (2014) 5: 1879-1886 [PMID:26682034]
ChEMBL	Inhibition of KDM6B (unknown origin ) incubated for 20 mins by Alphascreen assay	B	5.7	pIC50	2000	nM	IC50	Eur J Med Chem (2021) 226: 113855-113855 [PMID:34555614]
lysine demethylase 7A/Lysine-specific demethylase 7 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2163177] [GtoPdb: 2686] [UniProtKB: Q6ZMT4]
ChEMBL	Inhibition of KDM7A (unknown origin) using K27me2 peptide as substrate by MALDI assay	B	4.82	pIC50	15000	nM	IC50	J Med Chem (2013) 56: 7222-7231 [PMID:23964788]
Methylcytosine dioxygenase TET1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4523402] [UniProtKB: Q8NFU7]
ChEMBL	Inhibition of N-terminal 3xFlag-tagged human TET1 catalytic domain (E1418 to V2136 residues) expressed in Sf9 cells using 5-methylcytosine as substrate preincubated for 10 mins followed by DNA-cofactor addition and measured after 30 mins by Alphascreen assay	B	5.77	pIC50	1698.24	nM	IC50	J Med Chem (2024) 67: 4525-4540 [PMID:38294854]
Methylcytosine dioxygenase TET2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4523344] [UniProtKB: Q6N021]
ChEMBL	Inhibition of His10-FLAG tagged human TET2 catalytic domain (Q969 to I2002 residues) expressed in Sf9 cells using 5-methylcytosine as substrate preincubated for 10 mins followed by DNA-cofactor addition and measured after 10 mins by Alphascreen assay	B	5.29	pIC50	5128.61	nM	IC50	J Med Chem (2024) 67: 4525-4540 [PMID:38294854]
Methylcytosine dioxygenase TET3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4879414] [UniProtKB: O43151]
ChEMBL	Inhibition of human TET3 catalytic domain (E824 to I1795 residues) expressed in mammalian cells using 5-methylcytosine as substrate preincubated for 10 mins followed by DNA-cofactor addition and measured after 10 mins by Alphascreen assay	B	6.11	pIC50	776.25	nM	IC50	J Med Chem (2024) 67: 4525-4540 [PMID:38294854]
Prolyl 4-hydroxylase in Paramecium bursaria Chlorella virus 1 (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4523368] [UniProtKB: Q84406]
ChEMBL	Inhibition of N-terminal His6-tagged recombinant Paramecium bursaria chlorella virus 1 CPH expressed in Escherichia coli Rosetta 2 (DE3) cells pre-incubated for 5 mins before 2OG as substrate and Fe2 as co-factor addition in presence of L-ascorbate and measured after 5 mins MALDI TOF MS analysis	B	5.48	pKi	3280	nM	Ki	Bioorg Med Chem (2019) 27: 2405-2412 [PMID:30737136]
ChEMBL	Inhibition of N-terminal His6-tagged recombinant Paramecium bursaria chlorella virus 1 CPH expressed in Escherichia coli Rosetta 2 (DE3) cells pre-incubated for 5 mins before 2OG as substrate and Fe2 as co-factor addition in presence of L-ascorbate and measured after 5 mins MALDI TOF MS analysis	B	5.28	pIC50	5300	nM	IC50	Bioorg Med Chem (2019) 27: 2405-2412 [PMID:30737136]
RNA demethylase ALKBH5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3621037] [UniProtKB: Q6P6C2]
ChEMBL	Inhibition of ALKBH5 (unknown origin)	B	5.03	pIC50	9430	nM	IC50	J Med Chem (2021) 64: 16974-17003 [PMID:34792334]

ChEMBL data shown on this page come from version 34:

Zdrazil B, Felix E, Hunter F, Manners EJ, Blackshaw J, Corbett S, de Veij M, Ioannidis H, Lopez DM, Mosquera JF, Magarinos MP, Bosc N, Arcila R, Kizilören T, Gaulton A, Bento AP, Adasme MF, Monecke P, Landrum GA, Leach AR. (2024). The ChEMBL Database in 2023: a drug discovery platform spanning multiple bioactivity data types and time periods. Nucleic Acids Res., 52(D1). DOI: 10.1093/nar/gkad1004. [EPMCID:10767899] [PMID:37933841]
Davies M, Nowotka M, Papadatos G, Dedman N, Gaulton A, Atkinson F, Bellis L, Overington JP. (2015) 'ChEMBL web services: streamlining access to drug discovery data and utilities.' Nucleic Acids Res., 43(W1). DOI: 10.1093/nar/gkv352. [EPMCID:25883136]