ICOS ligand   Click here for help

GtoPdb Ligand ID: 9593

Abbreviated name: CD275
Synonyms: B7 homolog 2 | B7-H2 | B7-related protein 1 | B7RP-1 | ICOS-L
Immunopharmacology Ligand
Comment: Endogenous ligand for ICOS [1] that is expressed on the surface of antigen presenting cells. Inhibiting the ICOS/ICOSL axis is predicted to provide anti-inflammatory activity applicable for the treatment of autoimmune diseases.
The ICOSL protein contains an immunoglobulin (Ig)-like domain that resembles the antibody variable domain, that has been coined the 'V-set domain'. The genes for all human V-set domain containing proteins are listed in HGNC gene group 590.
The anti-ICOSL monoclonal antibody MEDI5872 (AMG557) is being evaluated in Phase 2 clinical trial in patients with primary Sjögren's syndrome (NCT02334306). Phase 1 trials of the same biologic in systemic lupus erythematosus (SLE) and psoriasis were terminated.
Species: Human
Peptide Sequence Click here for help
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRY
RNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTS
INGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD
KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Post-translational Modification
Signal peptide 1-18
Mature peptide 19-302
Transmembrane region 257-277