Synonyms: c-fos induced growth factor | FIGF
Compound class:
Endogenous peptide in human, mouse or rat
Species: Human
|
Peptide Sequence | |
FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEI SVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR |
Post-translational Modification | |
Homodimer formed by interchain disulphide bonds between cysteine residues at positions 48 and 57; further disulphide bonds formed between cysteine residues at positions 23 and 65, 54 and 101, and 58 and 103. N-linked glycosylation of asparagine residues at positions 67 and 97; predicted N-linked glycosylation of asparagine at 199 |