VEGFB   Click here for help

GtoPdb Ligand ID: 5086

Synonyms: VEGF-B | VEGF-related factor
Compound class: Endogenous peptide in human, mouse or rat
Comment: The active peptide is a homodimer linked by disulphide bonds
Species: Human
Peptide Sequence Click here for help
PVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQI
LMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAPS
TTSALTPGPAAAAADAAASSVAKGGA
Selected 3D Structures
PDB Id: 2c7w
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Homodimer formed by interchain disulphide bonds between cysteine residues at positions 51 and 60; further disulphide bonds formed between cysteine residues at positions 26 and 68, 57 and 102, and 61 and 103.