Vm24   Click here for help

GtoPdb Ligand ID: 10050

Synonyms: α-KTx 23.1 [1]
Immunopharmacology Ligand
Compound class: Peptide or derivative
Comment: Vm24 is a 36 amino acid peptide toxin that was isolated from the venom of the Mexican scorpion Vaejovis mexicanus smithi, and which was subsequently produced by chemical synthesis [1]. It acts as a selective blocker of the Kv1.3 potassium channel. Vm24 can be used to study the biological processes that are modulated by Kv1.3 blockade and to help identify the pathways that are key to Kv1.3's participation in normal and pathological states.
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC
Ala-Ala-Ala-Ile-Ser-Cys-Val-Gly-Ser-Pro-Glu-Cys-Pro-Pro-Lys-Cys-Arg-Ala-Gln-Gly-Cys-Lys-Asn-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-Lys-Cys-Tyr-Tyr-Cys-NH2
Post-translational Modification
Disulfide bonds: Cys6-Cys26, Cys12-Cys31, Cys16-Cys33, Cys21-Cys36.