From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

IL-7   Click here for help

GtoPdb Ligand ID: 4999

Synonyms: interleukin-7
Immunopharmacology Ligand
Comment: IL-7 is produced primarily by stromal cells and exerts its effects via a receptor complex consisting of IL-7 receptor alpha (IL7R) and a common IL-2 receptor gamma subunit (IL2RG). IL-7 signaling is essential for the establishment and maintenance of normal immune system functions. IL-7 stimulates the proliferation, differentiation, trafficking and survival of a variety of T cell subsets, including naive, central memory (CM), effector memory (EM), terminally differentiated effector memory (TEMRA) and natural killer (NK) T cells.
Species: Human
Peptide Sequence Click here for help
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLL
KVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 2 and 141, 24 and 129, and 47 and 92, predicted N-linked glycosylation of asparagine residues at positions 70, 91 and 116