GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-1α   Click here for help

GtoPdb Ligand ID: 4973

Synonyms: hematopoietin-1 | interleukin-1 alpha
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: IL-1α is an IL-1 family cytokine.
Species: Human
Peptide Sequence Click here for help
SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLY
VTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Selected 3D Structures
PDB Id: 2ila
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of asparagine at position 29