GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CXCL2   Click here for help

GtoPdb Ligand ID: 4424

Synonyms: macrophage inflammatory protein 2 (MIP-2)
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: This is the mouse homolog of human CXCL2.
Species: Mouse
Peptide Sequence Click here for help
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Ala-Val-Val-Ala-Ser-Glu-Leu-Arg-Cys-Gln-Cys-Leu-Lys-Thr-Leu-Pro-Arg-Val-Asp-Phe-Lys-Asn-Ile-Gln-Ser-Leu-Ser-Val-Thr-Pro-Pro-Gly-Pro-His-Cys-Ala-Gln-Thr-Glu-Val-Ile-Ala-Thr-Leu-Lys-Gly-Gly-Gln-Lys-Val-Cys-Leu-Asp-Pro-Glu-Ala-Pro-Leu-Val-Gln-Lys-Ile-Ile-Gln-Lys-Ile-Leu-Asn-Lys-Gly-Lys-Ala-Asn