From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

LH β subunit   Click here for help

GtoPdb Ligand ID: 4390

Synonyms: LH beta subunit | luteinising hormone subunit beta | luteinizing hormone subunit beta | lutropin subunit beta
Species: Rat
Is a component of
Peptide Sequence Click here for help
SRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPIV
SFPVALSCRCGPCRLSSSDCGGPRTQPMTCDLPHLPGLLLF
Ser-Arg-Gly-Pro-Leu-Arg-Pro-Leu-Cys-Arg-Pro-Val-Asn-Ala-Thr-Leu-Ala-Ala-Glu-Asn-Glu-Phe-Cys-Pro-Val-Cys-Ile-Thr-Phe-Thr-Thr-Ser-Ile-Cys-Ala-Gly-Tyr-Cys-Pro-Ser-Met-Val-Arg-Val-Leu-Pro-Ala-Ala-Leu-Pro-Pro-Val-Pro-Gln-Pro-Val-Cys-Thr-Tyr-Arg-Glu-Leu-Arg-Phe-Ala-Ser-Val-Arg-Leu-Pro-Gly-Cys-Pro-Pro-Gly-Val-Asp-Pro-Ile-Val-Ser-Phe-Pro-Val-Ala-Leu-Ser-Cys-Arg-Cys-Gly-Pro-Cys-Arg-Leu-Ser-Ser-Ser-Asp-Cys-Gly-Gly-Pro-Arg-Thr-Gln-Pro-Met-Thr-Cys-Asp-Leu-Pro-His-Leu-Pro-Gly-Leu-Leu-Leu-Phe
Post-translational Modification
N-linked glycosylation of the asparagine residue at position 13; disulfide bond formation between cysteine residues at positions 9 and 57; 23 and 72; 34 and 88; 38 and 90 and 93 and 100. The production of biologically active LH requires appropriately folded and glycosylated LHβ and common α subunits that assemble to form the active LH heterodimer