From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.
|
Synonyms: follitropin beta subunit | FSHβ | FSH-B | FSHB
Compound class:
Endogenous peptide in human, mouse or rat
Species: Mouse
|
| Is a component of |
| FSH |
Peptide Sequence ![]() |
|
|
SCELTNITISVEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNTQKVCTFKELVYETVRLPGCARHSDSLYTYPVATE CHCGKCDSDSTDCTVRGLGPSYCSFSEMKE |
|
| Post-translational Modification | |
| The production of biologically active FSH requires appropriately folded and glycosylated FSHβ and common α subunits that assemble to form the heterodimeric hormone. FSHβ is glysolyated at asparagine residues at positions 6 and 23, and disulfide bond formation occurs between cysteine residues at postions 2 and 50; 16 and 65; 19 and 103; 27 and 81; 31 and 83 and 86 and 93. The FSHβ and common alpha subunits then assemble to form the biologically active FSH heterodimer. | |