From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

CXCL13   Click here for help

GtoPdb Ligand ID: 3645

Synonyms: BCA-1
Immunopharmacology Ligand
Comment: CXCL13 is a C-X-C motif homeostatic chemokine that is selectively chemotactic for B cells belonging to both the B-1 and B-2 subsets. It exerts its biological effects via binding to the chemokine receptor CXCR5. CXCL13 expression can be regulated by the lymphotoxin β receptor (LTBR) pathway, and it contributes to ectopic tertiary lymphoid tissue development at sites of chronic inflammation in several autoimmune diseases, for example in the lacrimal and salivary glands of Sjögren's patients [4]. The CXCL13/LTBR axis is considered as a potential therapeutic target in conditions like Sjögren's syndrome. This is evidenced by the development of pharmaceutical agents that block LTBR activity being advanced to clinical trials (e.g. baminercept (BG9924) which is a soluble LTBR-IgG Fc fusion protein [3]).
Species: Human
Click here for help
Peptide Sequence Click here for help
VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVP
VFKRKIP
Val-Leu-Glu-Val-Tyr-Tyr-Thr-Ser-Leu-Arg-Cys-Arg-Cys-Val-Gln-Glu-Ser-Ser-Val-Phe-Ile-Pro-Arg-Arg-Phe-Ile-Asp-Arg-Ile-Gln-Ile-Leu-Pro-Arg-Gly-Asn-Gly-Cys-Pro-Arg-Lys-Glu-Ile-Ile-Val-Trp-Lys-Lys-Asn-Lys-Ser-Ile-Val-Cys-Val-Asp-Pro-Gln-Ala-Glu-Trp-Ile-Gln-Arg-Met-Met-Glu-Val-Leu-Arg-Lys-Arg-Ser-Ser-Ser-Thr-Leu-Pro-Val-Pro-Val-Phe-Lys-Arg-Lys-Ile-Pro
Post-translational Modification
Disulphide bond formation between cysteine residues at postions 11 and 48