From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

PACAP-(6-38)   Click here for help

GtoPdb Ligand ID: 2267

Synonyms: pituitary adenylate cyclase activating polypeptide (6-38)
Compound class: Peptide
Click here for help
Peptide Sequence Click here for help
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
Post-translational Modification
C-terminal residue is lysine amide