From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

[125I]CHIPS   Click here for help

GtoPdb Ligand ID: 1027

Synonyms: [125I]chemotaxis inhibitory protein of S. aureus
 Ligand is labelled  Ligand is radioactive
Compound class: Peptide
Click here for help
Peptide Sequence Click here for help
FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPL
AEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY